Animate Icons as You Wish.

customize animated svg icons into GIF / SVG / APNG from loading.io's icon collection.

Search
edit
or try one of these keywords:
/ / / / / /
Close

horny related icons

or try these keywords:
you dont saydeviousshadyhornydirty-mindedtrickycraftinesswililyslydeceitfuldeceptive

you dont say animated icon you dont say animated icon

other icons

that's all.

Need more? Try searching with some other similar terms.

Search

Nothing found for 'this keyword'

You can try searching with a shorter, broader keyword or terms with similar meaning

Search
Next Page



Loading Icons

customizable icon library built for animation


Loading.io's icon library provides thousands of icons that are all customizable and animatable. You can choose up to 100+ animations and apply to any icons you picked to generate customized images with various formats including GIF, SVG, APNG, PNG sequence, Lottie, MP4 and WebM.

CC-BY Free Icons

When using in static form, most icons in Loading.io's icon library are released under CC-BY License, which can be used freely with attribution.

wreath

Animatable

Loading icons are designed to be animated. We provide a handy collection of animation presets for you to apply on the icons you need, and generate the animation in desired format.

Animations can be customized and applied to single element of icons, making your design subtle and unique comparing to others.

Customizable

All icons we provided are customizable by colors, size as to animation types and speed. With our online icon editor you can make icons with transparent background or convert them into black and white easily.

You can also keep your customization in loading.io for future use, or share directly with others.

editor-screenshot
vector-editing

Vector format Image

All icons are designed with the loseless vector format SVG to optimize the image quality and file size.

In addition to SVG format, we also provide GIF / APNG / PNG Sequence format download for generating images in static form.

Lottie Powered

Maximize flexibility with Lottie format generation for using in mobile apps, web applications and programmatically control your animation.

Lottie generation is possible for icon, text and spinner animations as an alternative format for modern frameworks.

Lottie Line Drawing

Category

While not explicitly shown, all icons are designed with specific theme and topic. you can find some of them in the icon set page. Following are some sample categories available in loading.io:

License

All icons in their static form are released under Loading.io BY License ( simliar to CC-BY ), so you can download these free icons and use their static form in your projects with proper attribution; additionally, we also provide pro features for building animated images. You can subscribe and upgrade to pro account to unlock the animation features, or purchase per item to unlock the features only for the icon you need.

If you don't want to attribute, we also provide options for you to pay to remove attribution. To learn more about loading.io license, please check our license document.

Anything Missing?

Need any icons that are not listed here? Send us feedback and suggestion for the next icon to make!

Comments

Any questions or suggestion? Feel free to leave comment here. :)

Load Comments

By continuing to browse, you agree to our use of cookies.
For more details please check our privacy policy.

loading.io loader

Loading.io is brought to you by:
PlotDB Ltd. brand logo / 見聞科技有限公司 VAT No. 52518929

Service for making ajax loaders / loading gifs / preloaders and animated icons, live background, animated text in GIF / SVG / APNG / CSS.

Customer Service: [email protected]
LOADING.IO