maze

/Seamless repeatable background tiles in SVG / PNG / GIF / MP4
need pro features? Subscribe Now
More Patterns
Related Icons
plancertificatesproutsproutinfinitylinkdriplinkeclipsemessenger
Related Keywords
ringpiecoxcombnightingalesunburstcircleroundcolosseumarenamazespinnerloading

maze Pattern

animated, seamless repeatable background patterns for maze

A maze is a path or collection of paths, typically from an entrance to a goal. The word is used to refer both to branching tour puzzles through which the solver must find a route, and to simpler non-branching ("unicursal") patterns that lead unambiguously through a convoluted layout to a goal. (The term "labyrinth" is generally synonymous with "maze", but can also connote specifically a unicursal pattern.) The pathways and walls in a maze are typically fixed, but puzzles in which the walls and paths can change during the game are also categorised as mazes or tour puzzles.

— adopted from wikipedia, "maze", available under CC BY-SA License.

Usage

Animated repeating patterns can be used in various ways, such as in website background, or to fill HTML / SVG elements. You can also use them as slide / video background.

Here is an example of using animated pattern as background of an icon animation:

<div style="background:url(/your-pattern-url)"> <img src="your-icon-url"> </div>
rocket

Formats

All patterns can be generated in SVG / APNG / GIF formats. PNG sequence or static PNG are also available. To choose the right format for yourself, you should check the compatibility and quality of these file format before using them.

GIF

Provides the best compatibility, while big in size and low in quality. supports only up to 256 colors at most.

Supported by all browsers, even by old browser such as IE5 or Netscape.

SVG

Gives the best quality and file size but is CPU-intensive to render. Animation is more likely to lag when browser is busy

Animated SVG is not supported by IE or Edge.

APNG

Provides similar quality to SVG and is supported by most modern browsers, including Microsoft Edge.

However, its file size is proportional to image size, and isn't supported by older browser like IE.


Loading Patterns

seamless repeatable patterns built for animation

Loading Patterns is loading.io's animated pattern generator that makes tiled images for using as texture, image pattern or in backgrounds of app, video or website. It can also be used to fill shapes, icons or progress bars.

Seamless Repeatable

All background patterns generated in loading.io are seamless repeatable, either in static or animated format.

This significantly reduces the size of animated image, and is perfect for looping as background tile in any place with variant size.

Vector-based Image

Tiles are all designed based on lossless vector image format SVG with the capability to generate to other formats including GIF, PNG/APNG and PNG sequence.

SVG format keeps the highest quality of images against resizing while also optimizes the file size and possibility for flexible retouching.

svg editing

Animatable & Customizable

Loading.io empowers the background patterns with various types of animation which could be customized with loading.io's pattern editor.

All patterns are pre-designed but can still be customized according to your need.

License

All Patterns in their static form are released under Loading.io BY License ( similar to CC-BY ), so you can download these free patterns and use their static form in your projects with proper attribution; additionally, we also provide pro features for building animated images. You can subscribe and upgrade to pro account to unlock the animation features, or purchase per item to unlock the features only for the item you need.

If you don't want to attribute, we also provide options for you to pay to remove attribution. To learn more about loading.io license, please check our license document.

Comments

Any questions or suggestion? Feel free to leave comment here. :)

Load Comments

By continuing to browse, you agree to our use of cookies.
For more details please check our privacy policy.

loading.io loader

Loading.io is brought to you by:
PlotDB Ltd. brand logo / 見聞科技有限公司 VAT No. 52518929

Service for making ajax loaders / loading gifs / preloaders and animated icons, live background, animated text in GIF / SVG / APNG / CSS.

Customer Service: [email protected]
LOADING.IO